PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast09G200100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 392aa    MW: 42949.9 Da    PI: 4.8226
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast09G200100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.27.9e-5051321128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         lppG+rFhPtd el v+yLk+k+ g++l++ ++++++d+yk+ Pw+Lp k +++++++ewyfF+ rd+ky++g+r+nr+t +gyWkatgkd
  Brast09G200100.1.p   5 LPPGYRFHPTDVELTVYYLKRKLLGRPLRC-NAVTDIDLYKFAPWELPeKaSLQSGDREWYFFCMRDRKYSSGSRTNRSTVAGYWKATGKD 94 
                         79****************************.89**************95347788999********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++v+  k+++vg+k+tLvf+ g+ p+g++tdWvm eyrl
  Brast09G200100.1.p  95 RPVIY-KDQTVGMKRTLVFHAGKPPQGTRTDWVMYEYRL 132
                         *****.8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.58E-603155IPR003441NAC domain
PROSITE profilePS5100556.0745155IPR003441NAC domain
PfamPF023651.8E-256132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MATSLPPGYR FHPTDVELTV YYLKRKLLGR PLRCNAVTDI DLYKFAPWEL PEKASLQSGD  60
REWYFFCMRD RKYSSGSRTN RSTVAGYWKA TGKDRPVIYK DQTVGMKRTL VFHAGKPPQG  120
TRTDWVMYEY RLVDKDISSS DVKLDDCVIC KIFKKSGPGP KIGEQYGAPF KEEEWNDLNG  180
APSVPNSAPG SSNGVFNSAG QQLPVSDDGE ASLSPLSENN IERAANYNCA DASLDSIHIQ  240
HLADIIGHFS TKFSITAGQA AGGLPDLTAK YDNETLYELR PDLTADHNKL SFADETIFDE  300
LDKVPSGSVE SISKQCASCG GYWIEPMLEP VEGEQYFELN DLFSSLADDH PGPSCLVASN  360
DASHECHLDL ELNGISKSGK TSAVAAGSLP C*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B4e-53416116171NAC domain-containing protein 19
4dul_A4e-53416116171NAC domain-containing protein 19
1ut7_B4e-53416116171NO APICAL MERISTEM PROTEIN
1ut7_A4e-53416116171NO APICAL MERISTEM PROTEIN
1ut4_B4e-53416116171NO APICAL MERISTEM PROTEIN
1ut4_A4e-53416116171NO APICAL MERISTEM PROTEIN
3swp_D5e-53416119174NAC domain-containing protein 19
3swp_C5e-53416119174NAC domain-containing protein 19
3swp_B5e-53416119174NAC domain-containing protein 19
3swp_A5e-53416119174NAC domain-containing protein 19
3swm_D5e-53416119174NAC domain-containing protein 19
3swm_C5e-53416119174NAC domain-containing protein 19
3swm_B5e-53416119174NAC domain-containing protein 19
3swm_A5e-53416119174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003581627.10.0PREDICTED: NAC domain-containing protein 102-like
TrEMBLI1J1J60.0I1J1J6_BRADI; Uncharacterized protein
STRINGBRADI5G21010.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP148561721
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09330.48e-74NAC domain containing protein 82